PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G58850.1
Common NameATMYB119, MYB119
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 430aa    MW: 48512.7 Da    PI: 8.0623
Description myb domain protein 119
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G58850.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-17105151148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd +l+++v+q+G + W+ I++++  gR +kqc++rw+++l
      AT5G58850.1 105 KGQWTAEEDRKLIRLVRQHGERKWAMISEKLE-GRAGKQCRERWHNHL 151
                      799*****************************.*************97 PP

2Myb_DNA-binding46.21e-14158199245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + W++eE+  lv+ + + G++ W+ Ia+ ++ gRt++++k++w+
      AT5G58850.1 158 DGWSEEEERVLVESHMRIGNK-WAEIAKLIP-GRTENSIKNHWN 199
                      56*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129430.184100155IPR017930Myb domain
SuperFamilySSF466894.31E-29102198IPR009057Homeodomain-like
SMARTSM007175.0E-16104153IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-27106159IPR009057Homeodomain-like
CDDcd001674.11E-15108151No hitNo description
PfamPF139214.6E-19108166No hitNo description
PROSITE profilePS5129416.189156206IPR017930Myb domain
SMARTSM007172.0E-13156204IPR001005SANT/Myb domain
CDDcd001673.59E-10160202No hitNo description
Gene3DG3DSA:1.10.10.604.3E-19160204IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000115anatomysocket cell
PO:0000282anatomytrichome
PO:0000332anatomyepidermal pavement cell
PO:0005003anatomyshoot axis trichome
PO:0005660anatomyhydathode
PO:0006040anatomysepal epidermis
PO:0006056anatomycotyledon epidermis
PO:0006501anatomyleaf abscission zone
PO:0006504anatomyleaf trichome
PO:0009005anatomyroot
PO:0009031anatomysepal
PO:0020094anatomyplant egg cell
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MEDRRLVHGA APPLTAVERF LYGQKNDALC SKKQESSRDQ PIVKTKISIE TRSDNKENTT  60
FGPTREKHLV LNGGNRNPTG EVVARSAARD YQNSTKKRSS KNLIKGQWTA EEDRKLIRLV  120
RQHGERKWAM ISEKLEGRAG KQCRERWHNH LRPDIKKDGW SEEEERVLVE SHMRIGNKWA  180
EIAKLIPGRT ENSIKNHWNA TKRRQNSKRK HKRESNADNN DRDASPSAKR PCILQDYIKS  240
IERNNINKDN DEKKNENTIS VISTPNLDQI YSDGDSASSI LGGPYDEELD YFQNIFANHP  300
ISLENLGLSQ TSDEVTQSSS SGFMIKNPNP NLHDSVGIHH QEATITAPAN TPHLASDIYL  360
SYLLNGTTSS YSDTHFPSSS SSTSSTTVEH GGHNEFLEPQ ANSTSERREM DLIEMLSGSI  420
QGSNICFPLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-441032052104MYB PROTO-ONCOGENE PROTEIN
1h88_C5e-449220545158MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-449220545158MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-441032052104C-Myb DNA-Binding Domain
1msf_C1e-441032052104C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1201212KRRQNSKRKHKR
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible247749_at0.0
Expression AtlasAT5G58850-
AtGenExpressAT5G58850-
ATTED-IIAT5G58850-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor, member of the R2R3 factor gene family (MYB119).
Function -- GeneRIF ? help Back to Top
  1. MYB64 and MYB119 are expressed during the FG5 transition, and most myb64 myb119 double mutant gametophytes fail to initiate the FG5 transition, resulting in uncellularized gametophytes with supernumerary nuclei
    [PMID: 24068955]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00567DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G58850.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G58850
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3719780.0AF371978.1 Arabidopsis thaliana putative transcription factor MYB119 (MYB119) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568891.10.0myb domain protein 119
TrEMBLA0MFQ40.0A0MFQ4_ARATH; Putative uncharacterized protein (Fragment)
TrEMBLQ9FIM40.0Q9FIM4_ARATH; Myb domain protein 119
STRINGAT5G58850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42652656
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Wuest SE, et al.
    Arabidopsis female gametophyte gene expression map reveals similarities between plant and animal gametes.
    Curr. Biol., 2010. 20(6): p. 506-12
    [PMID:20226671]
  4. Rabiger DS,Drews GN
    MYB64 and MYB119 are required for cellularization and differentiation during female gametogenesis in Arabidopsis thaliana.
    PLoS Genet., 2013. 9(9): p. e1003783
    [PMID:24068955]